PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001650G0280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family NF-YA
Protein Properties Length: 308aa    MW: 33717.6 Da    PI: 9.8163
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001650G0280genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.54.5e-33153209158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep++VNaKQy++Il+RRqkRakle+++kl  k+rkpylheSRh+hA++R+RgsgGrF
  PH01001650G0280 153 EEPIFVNAKQYHAILRRRQKRAKLEAQNKL-VKGRKPYLHESRHRHAMKRARGSGGRF 209
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.2E-37151212IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.291152212IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.0E-28154209IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.6E-24155177IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860157177IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.6E-24186209IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MLTLLREMED HPVHPMSNYD FLSGNGYQMK QLGHKIYDQD SSSTKSGRSH QEASAMSDSS  60
LNEQQTSTQS DNDDGHGKHD QDTRKSVLSL GNPEAAFLPP KLDYNQSFAC IPYTADAYYG  120
GVLTGYASHA VVHGQLNGTT NSQVPLPVEP AAEEPIFVNA KQYHAILRRR QKRAKLEAQN  180
KLVKGRKPYL HESRHRHAMK RARGSGGRFL NTKQLEEQKQ QQQAAGGASC TKVLGKNTCL  240
QSGPTCAPSA SAPSDIANVS TSSKTLPNQE RIRFPSAGFR PIVNFSAQNG GDAKLAANGM  300
HQRVSIMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-23153214263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167174RRRQKRAK
2168175RRQKRAKL
3193202RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0967380.0FP096738.1 Phyllostachys edulis cDNA clone: bphylf045e19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235752.11e-156PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLA0A0Q3JTC41e-156A0A0Q3JTC4_BRADI; Uncharacterized protein
STRINGMLOC_67781.11e-150(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.17e-34nuclear factor Y, subunit A6